PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00094722001
Common NameGSBRNA2T00094722001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 268aa    MW: 28646.4 Da    PI: 7.553
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00094722001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.1e-3846106262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++++lkcprC+s ntkfCyynny+ sqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  GSBRNA2T00094722001  46 HHQSLKCPRCNSLNTKFCYYNNYNHSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSK 106
                          57899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-323799IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3248104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.19950104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MQDIHDYSMT GGGGGGGGGG RTGRFFGGGG GGDRRMRVHQ NNILNHHQSL KCPRCNSLNT  60
KFCYYNNYNH SQPRHFCKNC RRYWTKGGVL RNVPVGGGCR KAKRSKSKQP PSSSSTSTAD  120
KPMAQDGEEK PCSSESSSLP AGAATAAAAK GVMGADMHNI KLYGNGIEWS TLLGQGSSDG  180
GVFEMGGFTA LSIDTTPFGF GGNTVQQQFE DRTAQVDPTM EFEPLDWGSG GGDQTLFDLT  240
STADHAYWSH QDQNDLTFHN SDSFSSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.267881e-48leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00094722001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531381e-104AK353138.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-G03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111960.10.0PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR01e-105DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A078FV410.0A0A078FV41_BRANA; BnaA09g05460D protein
TrEMBLM4F4F60.0M4F4F6_BRARP; Uncharacterized protein
STRINGBra035956.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.16e-92OBF binding protein 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]